PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.D1N24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 374aa    MW: 40486.1 Da    PI: 8.0371
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.D1N24genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.38e-29196245251
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                  pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Araip.D1N24 196 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 245
                  9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-13193246IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-25194245IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-21196246IPR006447Myb domain, plants
PfamPF002497.6E-6197246IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MPLEGVFTSA SASASTSCMP LEGVFTSASA SASTSCVPDL SLHISPPTTT SYAGGHHTDL  60
SLGRREPPPP PPSLPTNMNH INEALRPIKG IPVYHNRSFP FLPMDRDHNN PNPKMCLYHH  120
MPASSSPFPV GVGLDPISFL NSGGAGGPYN NRVAAVAAAT SRFNNGIPSH QHHPLHHHYG  180
SRFLSKLPSK RSMRAPRMRW TSTLHARFVH AVELLGGHER ATPKSVLELM DVKDLTLAHV  240
KSHLQTTDKP AASSGLSDGS GEDEMSPPMG SSGMRQFQEQ RGQQDMDYSS TPTLWSNNSS  300
SNRDPWPQAN SNDIDGFRPI SMFQSQSIGH QIQQACDSTQ IKSSLSGSNN NLECKNPSLE  360
FTLGRPDWNG KGQA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016190350.10.0PREDICTED: transcription repressor KAN1-like isoform X1
SwissprotQ93WJ91e-71KAN1_ARATH; Transcription repressor KAN1
TrEMBLV7D2A61e-122V7D2A6_PHAVU; Uncharacterized protein
STRINGGLYMA11G33356.11e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-64G2-like family protein